Several typographical errors were introduced into the 178HA peptide sequence during printing. The sequence is the same as the DP-178 peptide, with the addition of a GGG linker and the HA epitope at the C-terminus. The correct sequence for this peptide is: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF GGGYPYDVPDYAGPG. We regret any confusion that this may have caused.
Additional information
The online version of the original article can be found at 10.1038/nsb0498-276
Nature Struct. Biol. 5, 276–279 (1998).
Rights and permissions
About this article
Cite this article
Furuta, R., Wild, C., Weng, Y. et al. Erratum: Capture of an early fusion-active conformation of HIV-1 gp41. Nat Struct Mol Biol 5, 612 (1998). https://doi.org/10.1038/871
Issue date:
DOI: https://doi.org/10.1038/871
This article is cited by
-
Restraining the conformation of HIV-1 gp120 by removing a flexible loop
The EMBO Journal (2006)