Table 1 Tau epitopes (identified by NMR) recognized by the anti-tau VHHs and kon, koff, and KD (affinity parameters) measured for each VHH and full-length tau2N4R or tau1N4R
From: Inhibition of tau neuronal internalization using anti-tau single domain antibodies
VHH | tau epitope | kon (M−1.s−1)*10+2 | koff (s−1)*10-3 | KD (nM) | |||
---|---|---|---|---|---|---|---|
2N4R | 1N4R | 2N4R | 1N4R | 2N4R | 1N4R | ||
B1-1 | 224KKVAVVR230 | 379 ± 25 | 608 ± 18 | 10.9 ± 0.66 | 27.9 ± 0.40 | 289 ± 26 | 460 ± 15 |
C3-2 | 243LQTAPVPMPDLKNVKSKI260 | 29 ± 0.2 | 29 ± 0.5 | 2.8 ± 0.02 | 2.5 ± 0.04 | 979 ± 12 | 857 ± 20 |
A31 | 275VQIINKKLDLSN286 | 3524 ± 26 | 3311 ± 24 | 12.3 ± 0.06 | 12.1 ± 0.06 | 35 ± 0.1 | 37 ± 0.1 |
Z70mut1 | 305SVQIVYKP312 | 1517 ± 30 | 1523 ± 30 | 65.8 ± 0.62 | 71.4 ± 0.65 | 434 ± 9 | 468 ± 10 |
A5-2 | 339VKSEKLDFKDRVQSKIGSLDNITHVPGGGNKK370 | 977 ± 41 | 618 ± 25 | 56.2 ± 1.15 | 32.4 ± 0.62 | 576 ± 27 | 525 ± 24 |
F8-2 | 369KIETHKLTFREN381 | 531 ± 11 | 575 ± 11 | 40 ± 0.40 | 42.5 ± 0.39 | 753 ± 17 | 740 ± 16 |
E2-2 | 449 ± 3 | 467 ± 3 | 3.8 ± 0.03 | 4.5 ± 0.04 | 84 ± 1 | 96 ± 1 | |
H3-2 | 6298 ± 31 | 5544 ± 25 | 5.6 ± 0.03 | 6.0 ± 0.03 | 8.9 ± 0.1 | 11 ± 0.1 |