Extended Data Fig. 1: Activation loop mutagenesis of Mec1. | Nature Structural & Molecular Biology

Extended Data Fig. 1: Activation loop mutagenesis of Mec1.

From: Mechanism of auto-inhibition and activation of Mec1ATR checkpoint kinase

Extended Data Fig. 1

a, Representative complete gel of Mec1 kinase assay, described in Fig. 2. The gel shown is for the experiment in Fig. 2a, WT. b, Kinase activity of Mec1 and Mec1(F2244L) as a function of Dna2(1-499). Phosphorylation rates are given below the gel. c, Kinase activity of Mec1 and Mec1(F2244L) as a function of Dna2-1 peptide: HHDFTQDEDGPMEEVIWKYSPLQRDMSDKT. Fold stimulation compared to wild-type Mec1 without activator is given. d, Phylogenetic analysis of the activation loop 2243DFD2245 motif. 640 eukaryotic Mec1/ATR sequences were aligned with MSAProbs (https://toolkit.tuebingen.mpg.de/), filtered to a set of 95 sequences that showed less than 50% sequence identity, and the motif distribution recorded. e, Titration of Rad53 into the Mec1 assay. Standard assays with 3 nM Mec1 and 5 nM Dna2(1-499) activator, or with 3 nM Mec1(F2244L) with or without 5 nM Dna2(1-499) activator were carried out at increasing concentrations of GST-Rad53-kd. Activities are expressed as Rad53 phosphates per Mec1 (monomer) per minute, and the data were modeled to the Michaelis-Menten equation. f, Ponceau staining of the extracts used for the Western blots in Fig. 2e.

Back to article page