Table 1 Potential candidate peptides information among upregulated peptide in Hepatozoon canis infected group.
Gene Names | Protein entry number | Protein names | Peptide sequence | Mass (Dalton) | Fold change value | -LOG 10 P-value | Gene Ontology (Biological process) | Gene Ontology (Molecular function) |
---|---|---|---|---|---|---|---|---|
Potential peptide biomarkers identified by Maldi-TOF-MS | ||||||||
FRMD8 | A0A8P0PM92 | FERM domain-containing protein 8 | AGTGEQGLLNAYCK | 1423.79 | 2.72 | 8.579 | N/A | N/A |
CAB39L | A0A8P0SA42 | Calcium binding protein 39 like | LLEFLSSFQKER | 1495.26 | 2.10 | 8.642 | N/A | N/A |
STX18 | A0A8I3ML77 | Syntaxin-18 | NNAGFRVWVLFFLVMCSFSLLFLD | 2837.66 | 2.20 | 9.015 | Intracellular protein ransport [GO:0006886]; Vesicle-mediated transport [GO:0016192] | Endoplasmic reticulum membrane [GO:0005789] |
TRIM28 | A0A8C0LTD6 | Tripartite motif containing 28 | HEPLVLFCESCDTLTCRDCQLNAHK | 2874.77 | 2.38 | 8.68 | N/A | Transcription corepressor activity [GO:0003714]; Zinc ion binding [GO:0008270] |
FNDC3B | A0A8C0SL00 | Fibronectin type III domain containing 3B | GEEATFQISGLQTNTDYRFRVCVCR | 2892.06 | 2.37 | 9.108 | N/A | N/A |
Potential peptide biomarkers identified by LC-MS | ||||||||
ZEB2 | A0A8I3N483 | Zinc finger E-box binding homeobox 2 | AYYAMNMEPNSDELLKISIAVGLPQEFVK | 3271.79 | 4.87 | 20.714 | Negative regulation of transcription by RNA polymerase II | DNA binding, DNA-binding Transcription factor activity, Metal ion binding |
TNS1 | A0A8P0P322 | Tensin 1 | EGRPHFWAR | 1155.28 | 3.43 | 17.22 | N/A | Phosphoprotein Phosphatase activity |
MTOR | A0A8C0Q917 | Serine/threonine-protein kinase mTOR | CFLKLGEWQLNLQGINESTIPK | 2531.95 | 3.76 | 17.195 | Negative regulation of autophagy, Positive regulation of protein metabolic process, Regulation of cellular component organization | ATP binding, protein serine/threonine kinase activity, Protein-containing complex binding |
THBS1 | A0A8I3PPU8 | Thrombospondin 1 | FYVVMWKQVTQSYWDTNPTRAQGYSGLSVK | 3541.00 | 3.46 | 20.599 | Cell adhesion, Cell migration, Chronic inflammatory response, Engulfment of apoptotic cell, Immune response, | Calcium ion binding, Collagen V binding, Endopeptidase inhibitor activity, Fibrinogen binding, Protein homodimerization activity |
THBS4 | A0A8P0NB64 | Thrombospondin 4 | AFSGSSQSPDSIELR | 1580.67 | 4.48 | 20.177 | Cell adhesion, Positive regulation of cell division, Response to unfolded protein | Calcium ion binding, Growth factor activity |
TNXB | A0A8P0SWE0 | Tenascin XB | EVLGSSADGALLVSLDGLR | 1872.11 | 2.49 | 19.59 | N/A | N/A |
CHD3 | A0A8C0NX13 | DNA helicase | CENDWRTSFPPGLCWGDRR | 2295.53 | 4.43 | 19.33 | Chromatin remodeling | ATP binding, DNA binding, Helicase activity, Hydrolase activity, Metal ion binding |
LAMA5 | A0A8C0TLC0 | Laminin subunit alpha 5 | AEAELLYADLRRGFEAFPELYWQAPPSYLGDR | 3745.17 | 3.99 | 19.275 | Cell adhesion, Regulation of cell adhesion, Regulation of cell migration, Regulation of embryonic development | Signaling receptor binding |
LAMA2 | A0A8P0SPP3 | Laminin subunit alpha 2 | ALAQGYYWSAPAPYLGNK | 1970.21 | 3.20 | 19.002 | Cell adhesion, regulation of cell adhesion, Regulation of cell migration, Regulation of embryonic development | Signaling receptor binding |
ITGB3 | A0A8I3PMU9 | Integrin beta | CECGSCVCIQPGSYGDTCEKCPTCPDACTFK | 3249.71 | 3.71 | 18.383 | Apolipoprotein A-I-mediated signaling pathway, Apoptotic cell clearance, Cell adhesion mediated by integrin | C-X3-C chemokine binding, Extracellular matrix binding, Fibroblast growth factor binding |
ACACA | A0A8C0P9A9 | Acetyl-CoA carboxylase 1 | AIIRHSDLVTKEASFEYLQNEGER | 2806.08 | 4.28 | 17.885 | Fatty acid biosynthetic process, Malonyl-CoA biosynthetic process | Acetyl-CoA carboxylase activity, ATP binding, Metal ion binding |
TAF1 | A0A8I3P7H0 | Transcription initiation factor TFIID subunit | DAGYGEKSFFAPEEENEEDFQMK | 2697.82 | 3.83 | 17.877 | DNA-templated transcription initiation | DNA binding, Histone acetyltransferase activity, Protein serine/threonine kinase activity |
FBN2 | A0A8I3NQU3 | Fibrillin 2 | AWNKPCEPCPTPGTADFK | 1962.23 | 2.62 | 17.799 | Bone trabecula formation, Camera-type eye development, Embryonic eye morphogenesis, Embryonic limb morphogenesis | Calcium ion binding |
MAST4 | A0A8I3NHR5 | non-specific serine/threonine protein kinase | AFISGAHPAQISAVSFVPLKALAGR | 2508.95 | 3.24 | 17.053 | N/A | ATP binding, magnesium ion binding, Protein serine/threonine kinase activity |