Fig. 5: Sex differences in the β4 interactome of male relative to female P84 mice. | Translational Psychiatry

Fig. 5: Sex differences in the β4 interactome of male relative to female P84 mice.

From: Impacts of CACNB4 overexpression on dendritic spine density in both sexes and relevance to schizophrenia

Fig. 5

A Volcano plot showing 13023 β4-IP enriched peptides that make up the β4 interactome. Enriched peptides with p < 0.05 are represented either in green (enriched in females) or red (enriched in males). Gray vertical lines (L–R) located at log2 fold change = −1, 1. B Table with the 18 significantly enriched peptides in males (with log2 fold change > 1) and 24 significantly enriched peptides in females (with log2 fold change < −1) revealed using paired Student’s t-tests of log2-transformed peak ratios. TMATAALAASPAPVSNLQGPYLASGDQPLDR (bolded, italicized) is significantly enriched in the β4 interactome of male relative to female P84 wildtype mice and is contained in the b isoform of the β1 subunit of voltage-gated calcium channels.

Back to article page