Fig. 1

Overview of α-SYN-C assay specificity. (A) Structure of α-Synuclein, indicating the α-SYN-C assay targeting the C-terminal region of α-Synuclein. (B) Sequence alignment of the targeted α-Synuclein sequence in human, mouse, bovine, and rat species (blue box). The sequence was aligned using UNIPROT. (C) Specificity of the α-SYN-C assay. Reactivity towards the standard peptide (EAYEMPSEEGYQDYEPEA), truncated peptide (AYEMPSEEGY), elongated peptide (NEAYEMPSEEG), full-length α-Synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA), and non-sense standard peptide (ELPARITPSQ). No background signal was detected when coating with a non-sense coating peptide (ELPARITPSQ-Biotin). Signals are shown as relative luminescence (RLU) per second, as a function of standard peptide.