Table 4 The identification of the potential markers used for the estimation of PMI in human liver tissues.
From: MALDI-TOF MS as a Novel Tool for the Estimation of Postmortem Interval in Liver Tissue Samples
Protein | Meas. M/z | Calc. MH+ | Number of matched peptides | Mascot Score | Sequence |
|---|---|---|---|---|---|
Rho GTPase-activating protein 24 | 3233.339 | 3233.619 | 4 | 44.20 | MGILNSDTLGNPTNVRNMSWLPNGYVTLR |
Amine oxidase | 3327.452 | 3328.533 | 5 | 32.70 | QPVDRIYFAGTETATHWSGYMEGAVEAGER |
Small vasohibin-binding protein | 686.286 | 686.329 | 1 | 14.50 | MDPPAR |
